PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597273.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 302aa    MW: 35305.9 Da    PI: 6.5371
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597273.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.91.5e-26175224352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +++ ledl+kyF+lpi +A+k+L+v+lTvLK++CR++GI+RWPhRkiksl
  XP_009597273.1 175 ARLALEDLAKYFDLPIVEASKSLKVGLTVLKKKCREFGIPRWPHRKIKSL 224
                     6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.497159244IPR003035RWP-RK domain
PfamPF020423.1E-22177224IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MFRSVHVYRT EGGKEEMEER EYLFHETSNF EETGFAPVIT LHKFDVSAQF VGIENGVWKC  60
MFVYDSGRHQ STSTNASPEW LSFAENPKME FIPTLANDLR AISELALNVE FRELSGRSST  120
EESGGNNIKS NQLDVKRRVP FLDLNSLPYS DSDIEENDQN ASENKKRRAA TKDIARLALE  180
DLAKYFDLPI VEASKSLKVG LTVLKKKCRE FGIPRWPHRK IKSLDSLIHD LQEEMQRQQE  240
EDELAAIAVE ERKRRIEYER ESIEKKPFMD IQKETKKFRQ DIFKRRYKAR VLENQCRTLP  300
LF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597270.10.0PREDICTED: protein RKD5 isoform X1
RefseqXP_009597271.10.0PREDICTED: protein RKD5 isoform X1
RefseqXP_016509390.10.0PREDICTED: protein RKD5-like isoform X1
RefseqXP_016509391.10.0PREDICTED: protein RKD5-like isoform X1
RefseqXP_016509392.10.0PREDICTED: protein RKD5-like isoform X1
TrEMBLA0A068U0G81e-122A0A068U0G8_COFCA; Uncharacterized protein
STRINGGLYMA01G36360.16e-84(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-59RWP-RK domain-containing protein